General Information

  • ID:  hor005954
  • Uniprot ID:  P18844
  • Protein name:  C-terminal peptide
  • Gene name:  scg5.L
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  7B2 family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004857 enzyme inhibitor activity; GO:0051082 unfolded protein binding
  • GO BP:  GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SVPHFSGEEE
  • Length:  10(199-208)
  • Propeptide:  MGMYSAIPLALPMVLLMVYGLTPSLGHSPRTPDRVSEADIQRLLHGVMEELGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPYGNIPNIVAELTGDNIPKDFREDQGYPNPPNPCPVGKTGDGCLEDTPDTAQFSREYQLHQNLYDPEHNYPGASTWNKKLLYEKIKGASQRQKRTVNPYLQGQKLDKVVAKKSVPHFSGEEE
  • Signal peptide:  MGMYSAIPLALPMVLLMVYGLTPSLG
  • Modification:  T6 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a molecular chaperone for pcsk2, preventing its premature activation in the regulated secretory pathway. Binds to inactive pcsk2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway w
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P18844-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005954_AF2.pdbhor005954_ESM.pdb

Physical Information

Mass: 127783 Formula: C48H68N12O19
Absent amino acids: ACDIKLMNQRTWY Common amino acids: E
pI: 3.98 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -103 Boman Index: -2393
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 29
Instability Index: 7555 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  27762356
  • Title:  Genome evolution in the allotetraploid frog Xenopus laevis.
  • PubMed ID:  2714283
  • Title:  The novel pituitary polypeptide 7B2 is a highly-conserved protein coexpressed with proopiomelanocortin.
  • PubMed ID:  2394742
  • Title:  The neuroendocrine polypeptide 7B2 is a precursor protein.
  • PubMed ID:  9648890
  • Title:  Manipulation of disulfide bon
  • PubMed ID:  11439082
  • Title: